PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01782.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 329aa    MW: 36760.1 Da    PI: 8.9344
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01782.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431e-131462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             rg+W++eEd +l  +++++G+g +W + + + g++R++k+c++rw++yl
  Rsa1.0_01782.1_g00001.1 14 RGPWSPEEDSKLRGYIEKYGNGgNWISFPLKAGLRRCGKSCRLRWLNYL 62
                             89*********************************************97 PP

2Myb_DNA-binding414.4e-1369111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++eEd ++  +++  G++ W+ Ia++++ gRt++++k++w++
  Rsa1.0_01782.1_g00001.1  69 GDFSEEEDMIIFSLFAAIGSR-WSIIAAHLP-GRTDNDIKNYWNT 111
                              789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.945962IPR017930Myb domain
SuperFamilySSF466891.64E-2612109IPR009057Homeodomain-like
SMARTSM007174.3E-81364IPR001005SANT/Myb domain
PfamPF002498.6E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-221569IPR009057Homeodomain-like
CDDcd001671.96E-71662No hitNo description
PROSITE profilePS5129422.17563117IPR017930Myb domain
SMARTSM007174.5E-1367115IPR001005SANT/Myb domain
PfamPF002494.6E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2370117IPR009057Homeodomain-like
CDDcd001677.28E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRAPCCDKT KVKRGPWSPE EDSKLRGYIE KYGNGGNWIS FPLKAGLRRC GKSCRLRWLN  60
YLRPNIKHGD FSEEEDMIIF SLFAAIGSRW SIIAAHLPGR TDNDIKNYWN TKLRKKLMSS  120
SSSSHSSSAM APPFLNPNSQ VVKRPSTTIS PSSYNPYFEN PTKALISNND CFEADNHQIF  180
PFVKTNYPQG LSLPESNNNN ISATSGFSLN HNMCDYYSNH NSFSSDANGN RSEIMMKQEE  240
IMMLMMIDNH IDQRTKGYNG DFTQGYYSNY INGHGNLKQM ISGTGTNSNI NMGGSGSESA  300
SSTSSISNLA ENKSSGSLLQ HKCLPYFYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013705724.10.0PREDICTED: transcription factor RAX1-like
SwissprotQ9FG681e-163RAX1_ARATH; Transcription factor RAX1
TrEMBLA0A0D3AKN30.0A0A0D3AKN3_BRAOL; Uncharacterized protein
STRINGBra020228.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140131623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23000.11e-159myb domain protein 37